General Information

  • ID:  hor003524
  • Uniprot ID:  B6DT16
  • Protein name:  Orcokinin-2(1-12)
  • Gene name:  NA
  • Organism:  Rhodnius prolixus (Triatomid bug)
  • Family:  Orcokinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rhodnius (genus), Triatominae (subfamily), Reduviidae (family), Reduvioidea (superfamily), Cimicomorpha (infraorder), Panheteroptera, Neoheteroptera, Euheteroptera, Heteroptera (suborder), Prosorrhyncha, Hemiptera (order), Paraneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  NFDEIDRSGFDG
  • Length:  12
  • Propeptide:  MSFFYSSAYAADKRNFDEIDRSGFNSFIKKKKNFDEIDRSGFDGFVKRNFDEIDRVGFGSFIKKSEPHH
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Myotropic
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-B6DT16-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003524_AF2.pdbhor003524_ESM.pdb

Physical Information

Mass: 156777 Formula: C58H82N16O23
Absent amino acids: ACHKLMPQTVWY Common amino acids: D
pI: 3.7 Basic residues: 1
Polar residues: 4 Hydrophobic residues: 3
Hydrophobicity: -112.5 Boman Index: -4517
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 32.5
Instability Index: 6359.17 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  19137558
  • Title:  The neuropeptidome of Rhodnius prolixus brain.